| Human Protein Atlas Number: | HPA011126 Human Protein Atlas characterization data |
| Кат. номер |
| HPA011126-100UL |
| HPA011126-25UL |
BTN1A1 (butyrophilin, subfamily 1, member A1) belongs to the BTN gene family, which resides within the major histocompatibility complex class I region on gene 6p22.1. This protein is composed of 526 amino acids and has a hydrophobic signal sequence at its N-terminal, which is made of 26 amino acids. The signal peptide is cleaved off before the secretion of the protein. BTN1A1 also belongs to immunoglobulin (Ig) superfamily, where the Ig domains are present in the extracellular region. The protein has a transmembrane region and short heptad repeats in the cytoplasmic tail. It is predominantly expressed in the epithelium of lactating mammary gland.
Butyrophilin subfamily 1 member A1 precursor recombinant protein epitope signature tag (PrEST)
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
BTN1A1 (butyrophilin, subfamily 1, member A1) is a milk protein which is secreted in milk in the lipid droplets. It controls the secretion of lipid droplets in milk, by interacting with xanthine dehydrogenase/oxidase, and acting either as a receptor or structural protein. Inactivation of this gene in mice leads to the formation of triacylglycerol pools in the cytoplasm. When present in dietary products, BTN1A1 leads to alterations in multiple sclerosis (MS). This is because of the similarity in the IgI domain of BTN1A1 and the IgV domain of myelin oligodendrocyte glycoprotein (MOG). MOG is the antigen for auto-antibodies, and is found on the myelin nerve sheath of MS patients.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Corresponding Antigen APREST71881,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| packaging | antibody small pack of 25 µL |
| application(s) | immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable |
| immunogen sequence | DYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGA |
| conjugate | unconjugated |
| UniProt accession no. | Q13410, |
| shipped in | wet ice |
| storage temp. | 20°C |
| Gene Information | human ... BTN1A1(696) |
| Personal Protective Equipment | Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), |
| RIDADR | NONH for all modes of transport |
| WGK Germany | WGK 1 |
| Flash Point F | Not applicable |
| Flash Point C | Not applicable |