| MDL number: | MFCD01864252 |
| Human Protein Atlas Number: | HPA005513 Human Protein Atlas characterization data |
| Кат. номер |
| HPA005513-100UL |
| HPA005513-25UL |
BIRC2 (baculoviral IAP repeat containing 2) is a member of the inhibitor of apoptosis protein (IAP) family. It is expressed almost exclusively in nucleus, which is mediated by its Bir domains. BIRC2 is a RING finger ubiquitin ligase (E3). This gene is localized to chromosome 11q22.
Baculoviral IAP repeat-containing protein 2 recombinant protein epitope signature tag (PrEST)
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Baculoviral IAP repeat containing 2 (BIRC2) is responsible for regulating NF-κB signaling, as well as apoptosis. It normally exists as a monomer, but is induced by proapoptotic signals to dimerize and undergo proteasomal degradation. It acts as an inhibitor of caspase, as well as a co-factor in tumor necrosis factor signaling. Studies suggest that, BIRC2 might regulate cell cycle, as it is accumulated in the midbody of cells in telophase stage. BIRC2 has also been proposed as an oncogene, as it degrades Mad-1, which is an antagonist of Myc. Degradation of Mad-1 leads to increased levels of Myc, which in turn promotes cell proliferation. It also regulates E2F1 transcription factor, and prevents its binding to DNA and E2F1-mediated transcriptional activation. BIRC2 is overexpressed in uterine cervix carcinoma of squamous cell type.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Corresponding Antigen APREST86198,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human, rat |
| packaging | antibody small pack of 25 µL |
| application(s) | immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 |
| immunogen sequence | NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF |
| conjugate | unconjugated |
| UniProt accession no. | Q13490, |
| shipped in | wet ice |
| storage temp. | 20°C |
| Gene Information | human ... BIRC2(329) |
| Personal Protective Equipment | Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), |
| RIDADR | NONH for all modes of transport |
| WGK Germany | WGK 1 |
| Flash Point F | Not applicable |
| Flash Point C | Not applicable |