SILu™Lite IFNG Interferon Gamma human

NACRES:

NA.12

Кат. номер

MSST0040-50UG

MSST0040-50UG-PW

Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. IFNγ is secreted by T helper cells (specifically, Th1 cells), cytotoxic T cells (TC cells) and Natural killer (NK) cells. When combined with other inflammatory cytokines, evaluating the levels of IFNγ can be used as a diagnostic tool in patients with breast cancer or benign prostatic hyperplasia. A recent study evaluated the effect of a cancer vaccine given to patients with colorectal cancer, on the levels of plasma pro-inflammatory cytokines (including IFN-γ). The study concluded that patients achieving stable disease showed increasing levels of plasma inflammatory cytokines.
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Biochem/physiol Actions
SILu™Lite IFNG is a recombinant human protein expressed in human 293 cells. It is a homodimer consisting of 138 amino acids Expressed in human 293 cells, with a calculated molecular mass of 17 kDa. SILu Lite IFNG is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Physical form
Lyophilized from a solution of phosphate buffered saline.
SILu is a trademark of Sigma-Aldrich Co. LLC

Quality Level	200
biological source	human
recombinant	expressed in HEK 293 cells
assay	98% (SDS-PAGE)
form	lyophilized powder
potency	98% Heavy amino acids incorporation efficiency by MS
mol wt	calculated mol wt 17 kDa
application(s)	mass spectrometry (MS): suitable
suitability	suitable for mass spectrometry (internal calibrator)
UniProt accession no.	P01579,
storage temp.	20°C
Gene Information	human ... IFNG(3458)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 2
Flash Point F	Not applicable
Flash Point C	Not applicable