| Human Protein Atlas Number: | HPA018911 Human Protein Atlas characterization data |
| Кат. номер |
| HPA018911-100UL |
| HPA018911-25UL |
The gene ARHGEF12 (Rho guanine nucleotide exchange factor 12) is mapped to human chromosome 11q23.3. The protein contains a PDZ (PSD-95/Dlg/ZO-1) domain, a LH/RGS (regulator of G protein signaling) domain, a DH (Dbl homology) domain and a PH (pleckstrin homology) domain. It is highly expressed in glioma, gastric cancer and intestinal cancer cell lines. In MDCK (Madin-Darby canine kidney)-II epithelial cells, the protein localizes at the lateral membranes and in the cytoplasm. However, ARHGEF12 has also been shown to co-localize with α-tubulin at the spindle poles and during cytokinesis, it is present in the midbody. ARHGEF12 is popularly called as LARG (Leukemia-associated RhoGEF).
Rho guanine nucleotide exchange factor 12 recombinant protein epitope signature tag (PrEST)
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
ARHGEF12 (Rho guanine nucleotide exchange factor-12) is a guanine nucleotide exchange factor. It connects G protein-coupled receptors (GPCRs) and heterotrimeric G proteins of the G12 family to Rho, thereby allowing cell surface receptors to activate Rho-dependent pathways. For instance, IGF1 (Insulin like growth factor 1) associates with ARHGEF12, thereby resulting in activation of Rho and Rho-associated kinase. Activation of Rho/Rho-kinase pathway induces cytoskeletal rearrangements in MDCK (Madin-Darby canine kidney)-II epithelial cells. ARHGEF12 binds to ATP-binding cassette transporter A1 (ABCA1). This interaction stabilizes ABCA1 and thus induces cholesterol efflux.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Corresponding Antigen APREST74816,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| packaging | antibody small pack of 25 µL |
| application(s) | immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:1000-1:2500 |
| immunogen sequence | MAASVKEQSTKPIPLPQSTPGEGDNDEEDPSKLKEEQHGISVTGLQSPDRDLGLESTLISSKPQSHSLSTSGKSEVRDLFVAERQFAKEQHTDGTLKEVGEDYQ |
| conjugate | unconjugated |
| UniProt accession no. | Q9NZN5, |
| shipped in | wet ice |
| storage temp. | 20°C |
| Gene Information | human ... ARHGEF12(23365) |
| RIDADR | NONH for all modes of transport |
| WGK Germany | WGK 1 |
| Flash Point F | Not applicable |
| Flash Point C | Not applicable |