Anti-MYC antibody produced in rabbit

Human Protein Atlas Number:

HPA055893    Human Protein Atlas characterization data

Кат. номер

HPA055893-100UL

HPA055893-25UL

The cellular myelocytomatosis (c-myc) is the cellular homologue of the v-myc gene originally isolated from an avian myelocytomatosis virus. The gene encoding it is mapped to human chromosome 8q24. It is a member of MYC gene family. c-Myc gene codes for basic helix-loop-helix/leucine zipper (bHLH/LZ) transcription factor that regulates the G1-S cell cycle transition.
MYC (MYC proto-oncogene) is a transcriptional factor and oncoprotein. c-myc is a member of MYC gene family. It is located on human chromosome 8q24. c-Myc gene codes for basic helix-loop-helix/leucine zipper (bHLH/LZ) transcription factor.
v-myc avian myelocytomatosis viral oncogene homolog
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
The cellular myelocytomatosis (c-myc) oncogene has a crucial role in cellular proliferation, differentiation, apoptosis and acts as transcriptional regulator of gene expression. c-myc expression is essential and sufficient to assist most of the cells to enter DNA synthetic (S) phase of the cell cycle. The encoded protein plays a crucial role in vasculogenesis and angiogenesis during cancer development and progression. c-myc interacts with its binding partner Max and activates the transcription of growth promoting genes such as cyclin D2 and ornithine decarboxylase. It also represses the transcription of multiple genes, especially p21 and p27, by binding to the transcription initiator element (Inr) in a complex with Max and either Sp1 or Miz1. Overexpression of MYC in DLBCL (diffuse large B-cell lymphoma) results in poor outcome and invasive treatment when medicated with rituximab plus cyclophosphamide, doxorubicin, vincristine and prednisone (R-CHOP).
MYC (MYC proto-oncogene) may be essential for cancer initiation, promotion and therapy resistance.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST88670,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50
isotype	IgG
immunogen sequence	SVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSE
conjugate	unconjugated
Featured Industry	Research Pathology
UniProt accession no.	P01106,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MYC(4609)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable