Anti-MYBL1 antibody produced in rabbit

Human Protein Atlas Number:

HPA008791    Human Protein Atlas characterization data

Кат. номер

HPA008791-100UL

HPA008791-25UL

MYBL1 (v-myb avian myeloblastosis viral oncogene homolog-like 1) gene is localized to human chromosome 8q13.1, and codes for a transcription factor. It is a member of the oncoprotein family called Myb. Its N-terminal contains DNA-binding repeats, and its C-terminal contains two conserved regions. Its c-Myb transactivation domain contains a putative leucine zipper.
Myb-related protein A recombinant protein epitope signature tag (PrEST)
These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Anti-MYBL1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
MYBL1 (v-myb avian myeloblastosis viral oncogene homolog-like 1) is partially duplicated in 28% of diffuse astrocytoma grade II tumors. This gene is characterized by recurrent oncogenic truncating rearrangements in pediatric low-grade gliomas. This gene is thought to be involved in the control of differentiation and proliferation of normal B-cells and Burkitt′s lymphoma cells. It also acts as an interacting partner of CBP (CREB-binding protein) protein, where its charged sequence binds with the CREB (cAMP response element-binding protein)-binding domain of CBP.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST71002,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunohistochemistry: 1:200- 1:500
immunogen sequence	EANAVLSSLQTIPEFAETLELIESDPVAWSDVTSFDISDAAASPIKSTPVKLMRIQHNEGAMECQFNVSLVLEGKKNTCNGGNSEAVPLTSPNIAKFSTPPAILRKKRKMRVGHSPGSELRDGSLNDGGN
conjugate	unconjugated
UniProt accession no.	P10243,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MYBL1(4603)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1