Anti-FST antibody produced in rabbit HPA018155-100UL

Human Protein Atlas Number:

HPA018155    Human Protein Atlas characterization data

Follistatin precursor recombinant protein epitope signature tag (PrEST)
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Follistatin (FST) regulates inflammatory responses by binding and inhibiting activin-A action. FST is an antagonist of bone morphogenetic proteins (BMPs). Balance between BMPs and FST is essential for regulation of skeleton patterning, chondrogenesis and bone formation. Presence of FST attenuates cigarette smoke-induced increase of inflammatory cells and mediators in the bronchoalveolar lavage fluid in mice. Baseline plasma FST is moderately elevated in type 2 diabetes patients. It is also identified as a candidate gene for productive HIV (human immunodeficiency virus)-1 replication in cultured Jurkat cells. Overexpression of FOXL2 (a forkhead/winged-helix family of transcription factor) induces FST expression, resulting in inhibition of activin-A-stimulated cell proliferation in human adult type granulosa cell tumors. Circulating FST levels were shown to be lower in gestational diabetes mellitus compared with normal glucose tolerance pregnant women. The levels were positively associated with fetal growth and neonatal adiposity.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73326,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
application(s)	immunoblotting: 0.4 µg/mL","immunohistochemistry: 1:50- 1:200
immunogen sequence	NCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECA
conjugate	unconjugated
UniProt accession no.	P19883,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... FST(10468)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	1