- Производитель:
- Sigma-Aldrich
| NACRES: | NA.85 |
About the Peptide Tag:This plasmid contains an n-terminal Thioredoxin (TRX) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is:SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGS.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains a constitutive bacterial promoter that does not require induction. It is the strongest bacterial promoter we sell and this can cause solubility and expression problems with some proteins. We also offer a range of other bacterial promoters that are compatible with this plasmid and are available on request.
Sequence
Analysis Note
| form | buffered aqueous solution |
| mol wt | size 4205 bp |
| conjugate | TRX tagged |
| Origin of replication | pUC (500 copies) |
| Peptide cleavage | TEV |
| Peptide tag location | N-terminal |
| Promoter | Promoter name: OXB20 Promoter activity: constitutive Promoter type: bacterial |
| bacteria selection | kanamycin |
| reporter gene | none |
| shipped in | ambient |
| storage temp. | 20°C |
| RIDADR | NONH for all modes of transport |
| Flash Point F | Not applicable |
| Flash Point C | Not applicable |
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.

