Каталог
Товары в наличии
Производители
Измерительные приборы
Перемешивание и встряхивание
Отбор проб и пробоподготовка
Перегонка, разделение и фильтрование
Нагревание и охлаждение
Дозирование жидкостей
Вакуумная техника
Микроскопы и оптика
Оборудование для очистки воды
Оборудование для очистки, дезинфекции и стерилизации
Анализ продуктов питания, воды и почв
Микробиология и биотехнология
Хроматография: приборы и принадлежности
Расходные материалы для лабораторий
Охрана труда и безопасность в лаборатории
Оборудование для фармацевтических и пищевых производств
Пилотное производство
Приборы для измерения крутящего момента
Лабораторная посуда
Мебель лабораторная
Химреактивы
Тестеры контроля качества фармацевтических препаратов
Sigma-Aldrich
Новинки
Antibodies
- Сортировать:
- Вид таблицей
-
Anti-GALK2 antibody produced in rabbit
Human Protein Atlas Number: HPA048267 Human Protein Atlas characterization data
Кат. номер HPA048267-100UL HPA048267-25UL Immunogengalactokinase 2 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST81520,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence EICAKSERYIGTEGGGMDQSISFLAEEGTAKLIEFSPLRATDVKLPSGAVFVIANSCVEMNKAATSHFNIRVMECRLAAKLLAKYK conjugate unconjugated UniProt accession no. Q01415, shipped in wet ice storage temp. 20°C Gene Information human ... GALK2(2585)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GALNT1 antibody produced in rabbit
Human Protein Atlas Number: HPA012628 Human Protein Atlas characterization data
Кат. номер HPA012628-100UL HPA012628-25UL General descriptionPolypeptide N-acetylgalactosaminyltransferase 1 (GALNT1) is localized to the Golgi apparatus. The gene encoding this protein is present on chromosome 18q12-q21.Immunogenpolypeptide N-acetylgalactosaminyltransferase 1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Polypeptide N-acetylgalactosaminyltransferase 1 (GALNT1) is involved in catalyzing the initial reaction of O-linked oligosaccharide biosynthesis. It has a wide range of protein substrates. GALNT1 transfers an N-acetyl-D-galactosamine residue to a serine or threonine residue which is present on the protein substrate.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72011,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence KERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPD conjugate unconjugated UniProt accession no. Q10472, shipped in wet ice storage temp. 20°C Gene Information human ... GALNT1(2589)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GALNT10 antibody produced in rabbit
Human Protein Atlas Number: HPA007525 Human Protein Atlas characterization data
Кат. номер HPA007525-100UL HPA007525-25UL Immunogenpolypeptide N-acetylgalactosaminyltransferase 10ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10) gene encodes a protein belonging to the GalNAc polypeptide N-acetylgalactosaminyltransferases. These proteins catalyzes the transfer of GalNAc from UDP-GalNAc to either serine or threonine residues of polypeptide acceptors. Protein glycosylation of target proteins is important in stabilizing the half-life, biological activity and receptor recognition of these proteins. GALNT10 promotes cell proliferation and inhibits apoptosis of hepatoma cells in a glycosyltransferase-dependent manner. It facilitates EGFR activation and hepatoma growth in HBV-associated hepatocarcinogenesis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71351,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:200- 1:500 immunogen sequence AGQGSHSRQKKTFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRS conjugate unconjugated UniProt accession no. Q86SR1, shipped in wet ice storage temp. 20°C Gene Information human ... GALNT10(55568)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GALNT11 antibody produced in rabbit
Human Protein Atlas Number: HPA039330 Human Protein Atlas characterization data
Кат. номер HPA039330-100UL HPA039330-25UL Immunogenpolypeptide N-acetylgalactosaminyltransferase 11ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72280,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:500- 1:1000 immunogen sequence LKTKSYGNISERVELRKKLGCKSFKWYLDNVYPEMQISGSHAKPQQPIFVNRGPKRPKVLQRGRLYHLQTNKCLVAQGRPSQKGGLVVLKACDYSDPNQIWIYNEEHELVLNSLLCLDMSETRSSDPPRLMKCHGSG conjugate unconjugated UniProt accession no. Q8NCW6, shipped in wet ice storage temp. 20°C Gene Information human ... GALNT11(63917)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GALNT13 antibody produced in rabbit
Human Protein Atlas Number: HPA060775 Human Protein Atlas characterization data
Кат. номер HPA060775-100UL HPA060775-25UL Immunogenpolypeptide N-acetylgalactosaminyltransferase 13ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST85581,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:20- 1:50 immunogen sequence ERSLLPALRAVISRNQEGPGEMG conjugate unconjugated UniProt accession no. Q8IUC8, shipped in wet ice storage temp. 20°C Gene Information human ... GALNT13(114805)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GALNT14 antibody produced in rabbit
Human Protein Atlas Number: HPA030138 Human Protein Atlas characterization data
Кат. номер HPA030138-100UL HPA030138-25UL Immunogenpolypeptide N-acetylgalactosaminyltransferase 14ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST90707,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence IREIILVDDFSNDPDDCKQLIKLPKVKCLRNNERQGLVRSRIRGADIAQGTTLTFLDSHCEVNRDWLQPLLHRVKEDYTRVVCPVIDIINLDTFTYIESASELRGGFDWSLHFQWEQL conjugate unconjugated UniProt accession no. Q96FL9, shipped in wet ice storage temp. 20°C Gene Information human ... GALNT14(79623)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GALNT14 antibody produced in rabbit HPA010785-100UL
Human Protein Atlas Number: HPA010785 Human Protein Atlas characterization data General descriptionGALNT14 (polypeptide N-acetylgalactosaminyltransferase 14) belongs to UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (pp-GalNAc-T) family of proteins. It forms a subfamily with pp-GalNAc-T2, and contains the conserved motifs characteristic of pp-GalNAc-T family. It is a type II membrane protein, and is ubiquitously expressed, though it has the highest expression in kidney. This gene is located on human chromosome 2p23.1.ImmunogenPolypeptide N-acetylgalactosaminyltransferase 14 recombinant protein epitope signature tag (PrEST)ApplicationAnti-GALNT14 antibody is suitable for immunoprecipitation. Anti-GALNT14 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
GALNT14 (polypeptide N-acetylgalactosaminyltransferase 14) belongs to the family of proteins, which is involved in the first step of O-glycosylation of proteins in mammals. They achieve this by the transfer of N-acetyl-D-galactosamine (GalNAc) to their peptide substrates. As GALNT14 has the highest expression in kidney, GALNT14 might play a role in O-glycosylation in kidney. Studies show this protein regulates insulin-like growth factor binding protein-3 (IGFBP-3) mediated apoptosis, as well as insulin-like growth factor binding protein-3 (IGFBP-3)-mediated signaling pathway. It is up-regulated in a variety of cancers such as, breast, ovarian, lung and skin cancer. In pancreatic carcinoma, non-small-cell lung carcinoma and melanoma cell lines the expression of GALNT14 is correlated with the sensitivity to Apo2L/TRAIL pathway. It can be used as a marker in breast cancer to determine the histological grade. SNP rs9679162, in gene GALNT14 is useful in predicting the outcome of chemotherapy in patients with advanced hepatocellular carcinoma.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72087,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human application(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable immunogen sequence KVAGMSPWAPQVPVSPTPPYQRGHLPTGGHLAVCHFPCLLQEAQFHLQTQVFLQVR conjugate unconjugated UniProt accession no. Q96FL9, shipped in wet ice storage temp. 20°C Gene Information human ... GALNT14(79623)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), WGK Germany 1 Узнать цену -
Anti-GALNT15 antibody produced in rabbit
Human Protein Atlas Number: HPA017076 Human Protein Atlas characterization data
Кат. номер HPA017076-100UL HPA017076-25UL Immunogenpolypeptide N-acetylgalactosaminyltransferase 15ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
GALNTL2 (Polypeptide N-acetylgalactosaminyltransferase-like protein 2) is a novel member of the human UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase (pp-GalNAc-T) family expressed in human tissues. It possesses unique catalytic activity. Member of this family transfer GalNAc from the sugar donor UDP-GalNAc to serine and threonine residues, which forms an α-anomeric linkage.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71925,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL, immunohistochemistry: 1:50-1:200 immunogen sequence GGSVEILPCSRVGHIYQNQDSHSPLDQEATLRNRVRIAETWLGSFKETFYKHSPEAFSLSKAEKPDCMERLQLQRRLGCRTFHWFLANVYPELYPSEPRPSFSGKLHNTGLG conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... GALNTL2(117248)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GALNT16 antibody produced in rabbit
Human Protein Atlas Number: HPA059136 Human Protein Atlas characterization data
Кат. номер HPA059136-100UL HPA059136-25UL Immunogenpolypeptide N-acetylgalactosaminyltransferase 16ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST85319,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence ATSTLMSSPGSPVILQMCNPREGKQKWRRKGSFIQHSVSGLCLETKPAQLVTSKCQADAQAQQWQLLPH conjugate unconjugated UniProt accession no. Q8N428, shipped in wet ice storage temp. 20°C Gene Information human ... GALNT16(57452)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GALNT18 antibody produced in rabbit
Human Protein Atlas Number: HPA012955 Human Protein Atlas characterization data
Кат. номер HPA012955-100UL HPA012955-25UL General descriptionPolypeptide N-acetylgalactosaminyltransferase 18 (GALNT18) belongs to the UDP-N-acetyl--D-galactosamine: polypeptide N-acetylgalactosaminyltransferase (GalNAc-Ts) family. It is a type-II transmembrane protein which has a short amino-terminal cytoplasmic tail, a stem region, a transmembrane region and a catalytic domain. GALNT18 is localized in the endoplasmic reticulum. The gene encoding it is present on chromosome 11p15.3.Immunogenpolypeptide N-acetylgalactosaminyltransferase 18ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Polypeptide N-acetylgalactosaminyltransferase 18 (GALNT18) catalyzes the first reaction during mucin-type O-glycans biosynthesis. It transfers an N-acetyl-D-galactosamine residue from the sugar donor, UDP-N-acetyl galactosamine (GalNAc) to a serine or threonine residue on the substrate protein. It may also acts as a chaperone or regulator in the glycosylation pathway. GALNT18 is suggested to have a novel role in the molecular mechanisms of O-glycosylation.†
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71777,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL, immunohistochemistry: 1:20-1:50 immunogen sequence SDIIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHVGILSPTVDDDDNRCLVDVNSRPRLIECSYAKAKRMKLHWQFSQGGPIQNRKSKRCLELQENSDLEFGFQLVLQKCSGQHWSITNVL conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... GALNTL4(374378)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GALNT2 antibody produced in rabbit
Human Protein Atlas Number: HPA011222 Human Protein Atlas characterization data
Кат. номер HPA011222-100UL HPA011222-25UL General descriptionGALNT2 (polypeptide N-acetylgalactosaminyltransferase 2) belongs to the ppGalNAc-T family, and is a type II transmembrane protein. The catalytic domain resides in the Golgi luminal region, and the R-type lectin domain lies in the C-terminal. This gene is localized to human chromosome 1q41-q42.Immunogenpolypeptide N-acetylgalactosaminyltransferase 2ApplicationAnti-GALNT2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
GALNT2 (polypeptide N-acetylgalactosaminyltransferase 2) catalyzes the first step of O-linked glycosylation of proteins. It is responsible for the attachment of first N-acetylgalactosamine (GalNAc) monosaccharide to the protein. The expression of this gene is up-regulated in cancers, and it might be involved in tumorigenesis. It suppresses the expression of matrix metalloproteinase (MMP)-2 and transforming growth factor (TGF)-1, and thus prevents proliferation and metastasis of gastric cancer cells. It modulates the development of placenta by regulating extravillus trophoblast (EVT) invasion. GALNT2 is also involved in insulin homeostasis by regulating the expression of ENPP1 (ectonucleotide pyrophosphatase), which is an inhibitor of insulin receptor signaling. Its expression is reduced in type 2 diabetes patients, and thus, it might play a role in hyperglycemia. It is up-regulated in oral squamous cell carcinoma (OSCC), and enhances the invasiveness of OSCC by modulating the O-glycosylation and activity of EGFR (epidermal growth factor receptor).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72034,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence SCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNL conjugate unconjugated UniProt accession no. Q10471, shipped in wet ice storage temp. 20°C Gene Information human ... GALNT2(2590)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GALNT4 antibody produced in rabbit
Human Protein Atlas Number: HPA076116 Human Protein Atlas characterization data
Кат. номер HPA076116-100UL HPA076116-25UL Immunogenpolypeptide N-acetylgalactosaminyltransferase 4ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST90516,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence IRFNSVTELCAEVPEQKNYVGMQNCPKDGFPVPANIIWHFKEDGTIFHPHSGLCLSAYRTPEGRPDVQMRTCDA conjugate unconjugated UniProt accession no. Q8N4A0, shipped in wet ice storage temp. 20°C Gene Information human ... GALNT4(8693)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GALNT5 antibody produced in rabbit
Human Protein Atlas Number: HPA008963 Human Protein Atlas characterization data
Кат. номер HPA008963-100UL HPA008963-25UL General descriptionGALNT5 (N-acetylgalactosaminyltransferase 5) is a highly tissue specific protein. It predominantly localizes to the cytoplasm of gastric epithelial and gastric cancer cells. This gene localizes to human chromosome 2q24.Immunogenpolypeptide N-acetylgalactosaminyltransferase 5ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
GALNT5 (N-acetylgalactosaminyltransferase 5) glycosylates restricted types of substrates. It is capable of interacting with Golgi proteins, by projecting its catalytic domain in the lumen of the Golgi complex. It might play a role in maintaining the structure of gastric mucosa, and less differentiated gastric tumor tissues show low expression of this protein. Its low expression is linked with TNM classification, and functions as an independent prognostic marker for poor outcome in gastric cancer patients. In breast cancer, missense mutation in this gene results in the loss of enzymatic function of this GALNT5 protein. This gene is also up-regulated in hepatoblastomas when compared to the expression in differentiated livers.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71964,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence AERDLNVTISLSTDRPKQRSQAVANERAHPASTAVPKSGEAMALNKTKTQSKEVNANKHKANTSLPFPKFTVNSNRLRKQSINETPLGSLSKDDGARGAHGKKLNFSESHLVIITKEEEQKADPKEVSNSKTKTIFPKVLGKS conjugate unconjugated UniProt accession no. Q7Z7M9, shipped in wet ice storage temp. 20°C Gene Information human ... GALNT5(11227)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GALNT8 antibody produced in rabbit
Human Protein Atlas Number: HPA073461 Human Protein Atlas characterization data
Кат. номер HPA073461-100UL HPA073461-25UL Immunogenpolypeptide N-acetylgalactosaminyltransferase 8ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST93145,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence QMKLFPHSQLFRQWGEDLSEAQQKAAQDLFRKFGYNAYLSNQLPLNRTIPDTRDYRCLRKTYPSQLPSLSVI conjugate unconjugated UniProt accession no. Q9NY28, shipped in wet ice storage temp. 20°C Gene Information human ... GALNT8(26290)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GALNT9 antibody produced in rabbit
Human Protein Atlas Number: HPA075016 Human Protein Atlas characterization data
Кат. номер HPA075016-100UL HPA075016-25UL Immunogenpolypeptide N-acetylgalactosaminyltransferase 9ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST93261,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence RVYNNTLTYGEVRNSKASAYCLDQGAEDGDRAILYPCHGMSSQLVRYSADGLLQL conjugate unconjugated UniProt accession no. Q9HCQ5, shipped in wet ice storage temp. 20°C Gene Information human ... GALNT9(50614)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GALNTL6 antibody produced in rabbit
Human Protein Atlas Number: HPA031019 Human Protein Atlas characterization data
Кат. номер HPA031019-100UL HPA031019-25UL Immunogenpolypeptide N-acetylgalactosaminyltransferase-like 6ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST77747,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence DKHLVKSAEPGEQQTFPLGLGDGQFYSWTDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPLTEEDHDDSAYRENGFNIFVSN conjugate unconjugated UniProt accession no. Q49A17, shipped in wet ice storage temp. 20°C Gene Information human ... GALNTL6(442117)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GALP antibody produced in rabbit
Human Protein Atlas Number: HPA053938 Human Protein Atlas characterization data
Кат. номер HPA053938-100UL HPA053938-25UL Immunogengalanin-like peptide recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86085,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:20- 1:50 immunogen sequence GYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKE conjugate unconjugated UniProt accession no. Q9UBC7, shipped in wet ice storage temp. 20°C Gene Information human ... GALP(85569)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GAMT antibody produced in rabbit HPA051806-100UL
Human Protein Atlas Number: HPA051806 Human Protein Atlas characterization data Immunogenguanidinoacetate N-methyltransferase recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST85484,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence DGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVP conjugate unconjugated UniProt accession no. Q14353, shipped in wet ice storage temp. 20°C Gene Information human ... GAMT(2593)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GAN antibody produced in rabbit
Human Protein Atlas Number: HPA049473 Human Protein Atlas characterization data
Кат. номер HPA049473-100UL HPA049473-25UL ImmunogengigaxoninApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST82077,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence ACGVAMELYVFGGVRSREDAQGSEMVTCKSEFYHDEFKRWIYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG conjugate unconjugated UniProt accession no. Q9H2C0, shipped in wet ice storage temp. 20°C Gene Information human ... GAN(8139)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GANC antibody produced in rabbit
Human Protein Atlas Number: HPA016949 Human Protein Atlas characterization data
Кат. номер HPA016949-100UL HPA016949-25UL ImmunogenNeutral alpha-glucosidase C recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
GANC (glucosidase, a; neutral C) is a novel member of the glycosyl hydrolase gene family 31. It possesses high α-glucosidase activity. It catalytically hydrolyzes α-linked glucose to convert it in simple and complex carbohydrates. Deficiency of GANC causes an inherited autosomal recessive disorder, Pompe disease (glycogen storage disease type II or acid maltase deficiency).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST70785,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence ASQPVMRPLWVEFPDELKTFDMEDEYMLGSALLVHPVTEPKATTVDVFLPGSNEVWYDYKTFAHWEGGCTVKIPVALDTIPVFQRGGSVIPIKTTVGKSTGWMTESSYGLRVALSTKGSSVGELYLDDGHSFQYLHQKQ conjugate unconjugated UniProt accession no. Q8TET4, shipped in wet ice storage temp. 20°C Gene Information human ... GANC(2595)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GAPVD1 antibody produced in rabbit
Human Protein Atlas Number: HPA029387 Human Protein Atlas characterization data
Кат. номер HPA029387-100UL HPA029387-25UL General descriptionGapvd1 (GTPase activating protein and VPS9 domains 1) is an endosome-associated protein and an activator of Rab. It is also known as RAP6 (Rab5-activating protein 6), Gapex-5 (GTPase activating protein) or RME-6 (receptor-mediated endocytosis protein 6).ImmunogenGTPase activating protein and VPS9 domains 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Gapvd1 (GTPase activating protein and VPS9 domains 1) interacts with Vav2 (vav guanine nucleotide exchange factor 2) and thereby modulates EGFR (epidermal growth factor receptor) stability. It also modulates vesicular trafficking processes like endocytosis of activated transmembrane proteins and exocytosis of GLUT4 (glucose transporter/solute carrier family 2) vesicles. Gapvd1 participates in phagosome maturation and also have a role in eye development or embryogenesis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST75360,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity rat, mouse, human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence AMTGSEEGDPRTKSSLGKFDKSCVAAFLDVVIGGRAVETPPLSSVNLLEGLSRTVVYITYSQLITLVNFMKSVMSGDQLREDRMALDNLLANLP conjugate unconjugated UniProt accession no. Q14C86, shipped in wet ice storage temp. 20°C Gene Information human ... GAPVD1(26130)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GAPVD1 antibody produced in rabbit HPA029386-100UL
Human Protein Atlas Number: HPA029386 Human Protein Atlas characterization data ImmunogenGTPase activating protein and VPS9 domains 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST75361,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity mouse, rat, human application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence SSLDLEGESVSELGAGPSGSNGVEALQLLEHEQATTQDNLDDKLRKFEIRDMMGLTDDRDISETVSETWSTDVLGSDFDPNIDEDRLQEIAGAAAENMLGSLLCLPGSGSVLL conjugate unconjugated UniProt accession no. Q14C86, shipped in wet ice storage temp. 20°C Gene Information human ... GAPVD1(26130)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GAR1 antibody produced in rabbit
Human Protein Atlas Number: HPA059098 Human Protein Atlas characterization data
Кат. номер HPA059098-100UL HPA059098-25UL ImmunogenGAR1 ribonucleoprotein homolog (yeast)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86044,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000 immunogen sequence GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT conjugate unconjugated UniProt accession no. Q9NY12, shipped in wet ice storage temp. 20°C Gene Information human ... GAR1(54433)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GAREM1 antibody produced in rabbit
Human Protein Atlas Number: HPA040709 Human Protein Atlas characterization data
Кат. номер HPA040709-100UL HPA040709-25UL ImmunogenGRB2 associated regulator of MAPK1 subtype 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST81719,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL, immunohistochemistry: 1:200-1:500 immunogen sequence ILPMHFPLHLTVPKFSLPEHLVKGESWPETLVHHWLGICQEQFDIDEYSRAVRDVKTDWNEECKSPKKGRCSGHNHVPNSLSYARDELTQS conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... GAREM(64762)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GAREM2 antibody produced in rabbit
Human Protein Atlas Number: HPA071575 Human Protein Atlas characterization data
Кат. номер HPA071575-100UL HPA071575-25UL ImmunogenGRB2 associated regulator of MAPK1 subtype 2 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST90346,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence REGHCYKLVSIISKTVVLGLALRREGPAPLHFLLLTDTPRFALPQGLLAGDPRVERLVRDSASYCRERFDPDEY conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... GAREML(150946)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GARNL3 antibody produced in rabbit
Human Protein Atlas Number: HPA074886 Human Protein Atlas characterization data
Кат. номер HPA074886-100UL HPA074886-25UL ImmunogenRecombinant protein corresponding to GTPase activating Rap/RanGAP domain like 3
Sequence
ISSDADGAIQRAGRFRVENGSSDENATALPGTWRRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRAILWRKTGTQKICLPYSPTKTLSVKSILApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL conjugate unconjugated UniProt accession no. Q5VVW2, shipped in wet ice storage temp. 20°C Gene Information human ... GARNL3(84253)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GART antibody produced in rabbit
Human Protein Atlas Number: HPA005779 Human Protein Atlas characterization data
Кат. номер HPA005779-100UL HPA005779-25UL ImmunogenTrifunctional purine biosynthetic protein adenosine-3 [Includes: Phosphoribosylamine--glycine ligase recombinant protein epitope signature tag (PrEST)
Sequence
LGDLLLTPTRIYSHSLLPVLRSGHVKAFAHITGGGLLENIPRVLPEKLGVDLDAQTWRIPRVFSWLQQEGHLSEEEMARTFNCGVGAVLVVSKEQTEQILRDIQQHKEEAWVIGSVVARAEGSPRVKVKNLIESMQINGSVLKNGSLTApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86225,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence LGDLLLTPTRIYSHSLLPVLRSGHVKAFAHITGGGLLENIPRVLPEKLGVDLDAQTWRIPRVFSWLQQEGHLSEEEMARTFNCGVGAVLVVSKEQTEQILRDIQQHKEEAWVIGSVVARAEGSPRVKVKNLIESMQINGSVLKNGSLT conjugate unconjugated UniProt accession no. P22102, shipped in wet ice storage temp. 20°C Gene Information human ... GART(2618)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GAS1 antibody produced in rabbit
Human Protein Atlas Number: HPA036085 Human Protein Atlas characterization data
Кат. номер HPA036085-100UL HPA036085-25UL Immunogengrowth arrest-specific 1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence TVIEDMLAMPKAALLNDCVCDGLERPICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGGEQPLDDDDG conjugate unconjugated UniProt accession no. P54826, shipped in wet ice storage temp. 20°C Gene Information human ... GAS1(2619)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GAS2L3 antibody produced in rabbit
Human Protein Atlas Number: HPA048593 Human Protein Atlas characterization data
Кат. номер HPA048593-100UL HPA048593-25UL Immunogengrowth arrest-specific 2 like 3ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST81092,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:1000- 1:2500 immunogen sequence LQFATLEQKILAFQKGVSNESVPDSPARTPQPPEMNPLSAVNMFQKQNSKPSVPVSIPKSKEKQGRPPGALVPASSLKGGNLGSMSVRSKLPNSPAASSHPKLKS conjugate unconjugated UniProt accession no. Q86XJ1, shipped in wet ice storage temp. 20°C Gene Information human ... GAS2L3(283431)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GAS6 antibody produced in rabbit
Human Protein Atlas Number: HPA056080 Human Protein Atlas characterization data
Кат. номер HPA056080-100UL HPA056080-25UL Immunogengrowth arrest-specific 6ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST91705,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence DCINKYGSPYTKNSGFATCVQNLPDQCTPNPCDRKGTQACQDLMGNFFCLCKAGWGGRLCDKDVNECSQEN conjugate unconjugated UniProt accession no. Q14393, shipped in wet ice storage temp. 20°C Gene Information human ... GAS6(2621)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GAS7 antibody produced in rabbit
Human Protein Atlas Number: HPA064678 Human Protein Atlas characterization data
Кат. номер HPA064678-100UL HPA064678-25UL Immunogengrowth arrest-specific 7ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88881,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:5000-1:10000 isotype IgG immunogen sequence SAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDLEMKTQQLEIKLSNKTEEDIKKGRRKS conjugate unconjugated UniProt accession no. O60861, shipped in wet ice storage temp. 20°C Gene Information human ... GAS7(8522)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GAS8 antibody produced in rabbit
Human Protein Atlas Number: HPA048238 Human Protein Atlas characterization data
Кат. номер HPA048238-100UL HPA048238-25UL Immunogengrowth arrest-specific 8 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST82225,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence KKEDHLEREMAEVSGQNKRLADPLQKAREEMSEMQKQLANYERDKQILLCTKARLKVREKELKDLQWEHEVLEQRFTKVQQERDELYRKFTAAIQ conjugate unconjugated UniProt accession no. O95995, shipped in wet ice storage temp. 20°C Gene Information human ... GAS8(2622)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GATA3 antibody produced in rabbit
Human Protein Atlas Number: HPA029731 Human Protein Atlas characterization data
Кат. номер HPA029731-100UL HPA029731-25UL General descriptionThe gene GATA3 (GATA-binding factor 3) is mapped to human chromosome 10p14. It belongs to the GATA family of transcription factors. The protein has two transactivation domains and two zinc fingers. It is mainly present in hematopoietic and nonhematopoietic tissues/cells such as mammary glands and T cells.ImmunogenGATA binding protein 3 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Anti-GATA3 antibody produced in rabbit has been used in immunohistochemistry.
Biochem/physiol Actions
GATA3 (GATA-binding factor 3) is required for T cell development, activation, proliferation, homeostasis and effector activities. It can downregulate the activity of GCM1 (glial cells missing homolog 1) and thereby controls trophoblast invasion. Mutations in GATA3 gene are associated with various disease including asthma, allergy, cancer and leprosy. It is also associated with breast cancer progression.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST78065,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:500-1:1000 immunogen sequence MKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHP conjugate unconjugated Featured Industry Research Pathology UniProt accession no. P23771, shipped in wet ice storage temp. 20°C Gene Information human ... GATA3(2625)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GATA4 antibody produced in rabbit
Human Protein Atlas Number: HPA073899 Human Protein Atlas characterization data
Кат. номер HPA073899-100UL HPA073899-25UL ImmunogenGATA binding protein 4ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST93173,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence PFDSPVLHSLPGRANPAARHPNLDMFDDFSEGRECV conjugate unconjugated UniProt accession no. P43694, shipped in wet ice storage temp. 20°C Gene Information human ... GATA4(2626)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GATA5 antibody produced in rabbit
Human Protein Atlas Number: HPA067583 Human Protein Atlas characterization data
Кат. номер HPA067583-100UL HPA067583-25UL ImmunogenGATA binding protein 5ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST92741,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence GTSYSATYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRE conjugate unconjugated UniProt accession no. Q9BWX5, shipped in wet ice storage temp. 20°C Gene Information human ... GATA5(140628)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GATA6 antibody produced in rabbit
Human Protein Atlas Number: HPA066629 Human Protein Atlas characterization data
Кат. номер HPA066629-100UL HPA066629-25UL ImmunogenGATA binding protein 6ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST90182,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence INKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGE conjugate unconjugated UniProt accession no. Q92908, shipped in wet ice storage temp. 20°C Gene Information human ... GATA6(2627)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GATAD1 antibody produced in rabbit
Human Protein Atlas Number: HPA072785 Human Protein Atlas characterization data
Кат. номер HPA072785-100UL HPA072785-25UL ImmunogenGATA zinc finger domain containing 1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST93103,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGR conjugate unconjugated UniProt accession no. Q8WUU5, shipped in wet ice storage temp. 20°C Gene Information human ... GATAD1(57798)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GATB antibody produced in rabbit
Human Protein Atlas Number: HPA042610 Human Protein Atlas characterization data
Кат. номер HPA042610-100UL HPA042610-25UL Immunogenglutamyl-tRNA(Gln) amidotransferase, subunit BApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST79686,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL, immunofluorescence: 0.25-2 µg/mL, immunohistochemistry: 1:500-1:1000 immunogen sequence WKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKK conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... PET112L(5188)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GATSL2 antibody produced in rabbit
Human Protein Atlas Number: HPA057229 Human Protein Atlas characterization data
Кат. номер HPA057229-100UL HPA057229-25UL ImmunogenGATS protein-like 2ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:200- 1:500 isotype IgG immunogen sequence FDHALVPEENINGVISALKVSQAEKH conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... GATSL1(389523)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GBA antibody produced in rabbit
Human Protein Atlas Number: HPA006667 Human Protein Atlas characterization data
Кат. номер HPA006667-100UL HPA006667-25UL General descriptionGBA (glucosidase, , acid) is a simple glycosphingolipid. It consists of three non-contiguous domains, with the active catalytic site located in domain III and a (/a)8 (TIM) barrel. In mammals, it is hydrolyzed by the lysosomal enzyme. 1,4 mutation in GBA gene leads to several neurological diseases, such as Parkinson disease (PD) and type 1 Gaucher disease (GD). In GD, -glucosidase activity is significantly low.ImmunogenGlucosylceramidase precursor recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST70725,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence YSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYN conjugate unconjugated UniProt accession no. P04062, shipped in wet ice storage temp. 20°C Gene Information human ... GBA(2629)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GBA2 antibody produced in rabbit
Human Protein Atlas Number: HPA024026 Human Protein Atlas characterization data
Кат. номер HPA024026-100UL HPA024026-25UL ImmunogenNon-lysosomal glucosylceramidase recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST75174,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence HDTADWKDLNLKFVLQVYRDYYLTGDQNFLKDMWPVCLAVMESEMKFDKDHDGLIENGGYADQTYDGWVTTGPSAYCGGLWLAAVAVMVQMAALCGAQDIQDKFSSILSRGQEAYERLLWNGRYYNYDSSSRPQSRSVMSDQCA conjugate unconjugated UniProt accession no. Q9HCG7, shipped in wet ice storage temp. 20°C Gene Information human ... GBA2(57704)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GBF1 antibody produced in rabbit
Human Protein Atlas Number: HPA037760 Human Protein Atlas characterization data
Кат. номер HPA037760-100UL HPA037760-25UL Immunogengolgi brefeldin A resistant guanine nucleotide exchange factor 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST80218,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence LTSVNKFLSYALIDPTHEGTAEGMENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKS conjugate unconjugated UniProt accession no. Q92538, shipped in wet ice storage temp. 20°C Gene Information human ... GBF1(8729)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GBGT1 antibody produced in rabbit
Human Protein Atlas Number: HPA051298 Human Protein Atlas characterization data
Кат. номер HPA051298-100UL HPA051298-25UL Immunogengloboside alpha-1,3-N-acetylgalactosaminyltransferase 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST85565,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence HMAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLR conjugate unconjugated UniProt accession no. Q8N5D6, shipped in wet ice storage temp. 20°C Gene Information human ... GBGT1(26301)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GBP2 antibody produced in rabbit HPA042682-100UL
Human Protein Atlas Number: HPA042682 Human Protein Atlas characterization data Immunogenguanylate binding protein 2, interferon-inducible recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST83605,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence ERLLKEGFENESKRLQKDIWDIQMRSKSLEPICNIL conjugate unconjugated UniProt accession no. P32456, shipped in wet ice storage temp. 20°C Gene Information human ... GBP2(2634)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GBP3 antibody produced in rabbit
Human Protein Atlas Number: HPA045657 Human Protein Atlas characterization data
Кат. номер HPA045657-100UL HPA045657-25UL Immunogenguanylate binding protein 3 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST84438,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:1000- 1:2500 immunogen sequence LLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHK conjugate unconjugated UniProt accession no. Q9H0R5, shipped in wet ice storage temp. 20°C Gene Information human ... GBP3(2635)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GBP5 antibody produced in rabbit
Human Protein Atlas Number: HPA028656 Human Protein Atlas characterization data
Кат. номер HPA028656-100UL HPA028656-25UL Immunogenguanylate binding protein 5 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST76919,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:5000-1:10000 immunogen sequence TDQALTETEKKKKEAQVKAEAEKAEAQRLAAIQRQNEQMMQERERLHQEQVRQMEIAKQNWLAEQQKMQEQQMQEQAAQLSTTFQAQNRSLLSELQHAQRTVNNDDPCVLL conjugate unconjugated UniProt accession no. Q96PP8, shipped in wet ice storage temp. 20°C Gene Information human ... GBP5(115362)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GBP7 antibody produced in rabbit
Human Protein Atlas Number: HPA051245 Human Protein Atlas characterization data
Кат. номер HPA051245-100UL HPA051245-25UL Immunogenguanylate binding protein 7 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST84845,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:200- 1:500 immunogen sequence FQENIAQLKKKMERERENYMRELRKMLSHKMKVLEELLTEGFKEIFESLNEEINRLKEQIEAA conjugate unconjugated UniProt accession no. Q8N8V2, shipped in wet ice storage temp. 20°C Gene Information human ... GBP7(388646)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GBX1 antibody produced in rabbit
Human Protein Atlas Number: HPA055783 Human Protein Atlas characterization data
Кат. номер HPA055783-100UL HPA055783-25UL Immunogengastrulation brain homeobox 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86084,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:20- 1:50 immunogen sequence ATAARNNPEPGGRRPEGGLEADEL conjugate unconjugated UniProt accession no. Q14549, shipped in wet ice storage temp. 20°C Gene Information human ... GBX1(2636)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
