Узнать цену

Производитель может поднять цены — запросите коммерческое предложение сейчас, и мы зафиксируем за вами текущую цену.

  • Привезем под заказ
  • Срок поставки с завода 6-8 недель

SILu™Prot APOA1, Apolipoprotein A-1 human

Гарантия 1 год
Производитель:
Sigma-Aldrich
Онлайн консультант Анна Головацкая
Онлайн консультант Анна Головацкая Получить консультацию эксперта
Производитель:
Sigma-Aldrich
Кат. номер
MSST0001-10UG
MSST0001-10UG-PW

General description
ApoA-1 (apolipoprotein A-1) is a 29.0kDa protein produced in the liver and intestine, and secreted as the predominant constituent of nascent high-density lipoprotein (HDL) particle. BP- ApoA-1 (apolipoprotein A-1), which is found exclusively in HDL (high-density lipoprotein), has a unique ability to capture and solubilize free cholesterol. This apoA-1 ability enables HDL to remove excess peripheral cholesterol and return it to the liver for recycling and excretion. The therapeutic potential of apoA-1 has been recently assessed in patients with acute coronary syndromes, using a recombinant form of a naturally occurring variant of apoA-1 (called apoA-1 Milano). The availability of recombinant normal apoA-1 should facilitate further investigation into the potential usefulness of apoA-1 in preventing atherosclerotic vascular diseases. Changes in the level of serum apoA-1 may serve as a prognostic marker for non-metastatic nasopharyngeal carcinoma. Low levels of apoA-1 in the plasma are linked to hyperhomocysteinemia.
Application
Posters:
Characterization of Heavy Recombinant Proteins for Use as Internal Standards in Quantitative MS Workflows,
Characterization of stable isotope labeled APO-A1 for use as an internal standard in a quantitative MS workflow,
Characterization of Clinically-Relevant Stable Isotope Labeled Recombinant Proteins for Use as Internal Standards in Quantitative MS Workflows,
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.
Preparation Note
Briefly centrifuge the vial before opening. It is recommended to reconstitute the protein in sterile ultrapure water to a final concentration of 100μg/ml.
Storage and Stability
Store the lyophilized product at –20 oC. The product is stable for at least 2 years as supplied. After reconstitution, it is recommended to store the protein in working aliquots at –20 oC.
Analysis Note
General description
SILu™Prot ApoA is a recombinant, stable isotope-labeled human Apo A1 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of ApoA1 in mass-spectrometry. SILu Prot Apo A- is a monomer of 280 amino acids (including C-terminal polyhistidine and V5 tags), with an apparent molecular weight of 32.3 kDa.
Sequence
RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLK
LLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKV
QPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEM
RDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEK
AKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQSDPSRGPFEGK
PIPNPLLGLDSTRTGHHHHHHHHGGQ

The N-terminal signal peptide and C-terminal linker peptide, V5 and polyhistidine tags are italicized. Suggested transitions for three peptides (bolded) are used for selected reaction monitoring analysis (SRM).
Label Incorporation
98% as determined by mass spectrometry
Other Characterization
  • Sequence confirmed by intact mass analysis
  • Identity verified by peptide mapping
  • Purity >98% by SDS-PAGE
  • Vial content was determined by the Bradford method using BSA as a calibrator. The correction factor of Bradford-to-AAA is 88.33%

Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides,)
Legal Information
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC
Параметры
Quality Level200
biological sourcehuman
recombinantexpressed in HEK 293 cells
assay98% (SDS-PAGE)
formlyophilized powder
packagingvial of 10-13 µg (Lot-specific vial content given on certificate of analysis)
application(s)mass spectrometry (MS): suitable
conjugateHis tagged","V5 tagged
UniProt accession no.P02647,
storage temp.20°C
Gene Informationhuman ... APOA1(335)

Safety Information
RIDADRNONH for all modes of transport
WGK GermanyWGK 2
Flash Point FNot applicable
Flash Point CNot applicable
Пуско-наладка
Выполним распаковку, визуальную проверку, сборку и установку, запуск и настройку, проверку функциональности, проведем инструктаж персонала.
Техническое обслуживание
Проведем периодические регламентные работы: визуальный осмотр, очистка засоренных узлов и частей, замена расходных материалов и изношенных деталей, тестирование прибора, проверка показателей и измерение параметров, калибровка и настройка, обновление программного обеспечения.
IQ/OQ/PQ квалификация, валидация
Проведем монтажную (IQ), операционную (OQ) и эксплуатационную (PQ) квалификацию оборудования по протоколам производителя в полном соответствии с стандартами GMP/GLP.
Ремонт
Проведем диагностику в нашем сервисном центре или у Вас на предприятии, выявим причину поломки, устраним неисправность, проведем тестирование, настройку, калибровку отремонтированного оборудования.

Получите коммерческое предложение в течение 1 часа

Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа

Анна Гловацкая Менеджер по работе с клиентами
Получите коммерческое предложение в течение 1 часа
Как к вам обращаться?
Введите телефон
Введите email
Комментарий (если есть)
Прикрепить ТЗ или заявку (до 10 мб)

С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии

Обрудование подберут сотрудники с высшим химическим образованием

Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.

Организуем поставку с завода- изготовителя за 6-8 недель

У большинства компаний срок ожидания составляет 10-12 недель.

Храним оборудование по требованиям производителя

Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.

Доставим по Москве на следующий день, по России — за 3-4 дня

Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.

Выполним бесплатный ремонт и сервисное обслуживание

В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.

Обеспечим легкое внедрение на предприятие

Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.

Отзывы

Узнать цену

Производитель может поднять цены — запросите коммерческое предложение сейчас, и мы зафиксируем за вами текущую цену.

  • Привезем под заказ
  • Срок поставки с завода 6-8 недель

SILu™Prot APOA1, Apolipoprotein A-1 human

Гарантия 1 год
Производитель:
Sigma-Aldrich
Онлайн консультант Анна Головацкая
Онлайн консультант Анна Головацкая Получить консультацию эксперта

Похожие товары: