SILu™Lite COL1A1 N-terminal propeptide human

Кат. номер

MSST0034-50UG

MSST0034-50UG-PW

Collagen type I is present in soft connective tissues and bone, where it constitutes more than 90% of the organic matrix.1 During bone formation collagen type I is synthesized from pro-collagen type I, which is secreted from fibroblasts and osteoblasts.2 Pro-collagen type I contains N-and C-terminal extensions, which are removed by specific proteases during the conversion of procollagen to collagen.3 Measurements of N- terminal propeptides of procollagen type I (PINP) can be of value in assessing bone formation. Recent evidence indicates that PINP can serve as a serum biomarker of bone formation, as it accurately identifies those patients who are responding to anabolic or antiresorptive therapy within 3 months of the start of treatment.4 The use of this biomarker in patients being treated for osteoporosis may significantly improve therapy adherence and clinical outcomes.4
QEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPDYKDDDDKGHHHHHHHHGGQ
Biochem/physiol Actions
SILu™Lite COL1A1 recombinant human protein expressed in human 293 cells. It is a protein of 159 amino acids (Q23-P161 and including C-terminal polyhistidine and FLAG® tags) with a calculated molecular mass of 16 kDa. SILu Lite COL1A1 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Physical form
Lyophilized from a solution of phosphate buffered saline.
FLAG is a registered trademark of Sigma-Aldrich Co. LLC
SILu is a trademark of Sigma-Aldrich Co. LLC

Quality Level	200
biological source	human
recombinant	expressed in HEK 293 cells
assay	98% (SDS-PAGE)
form	lyophilized powder
potency	98% Heavy amino acids incorporation efficiency by MS
application(s)	mass spectrometry (MS): suitable
suitability	suitable for mass spectrometry (internal calibrator)
UniProt accession no.	P02452,
storage temp.	20°C
Gene Information	human ... COL1A1(1277)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 2
Flash Point F	Not applicable
Flash Point C	Not applicable