Anti-SETDB1 antibody produced in rabbit

MDL number:	MFCD07370494
Human Protein Atlas Number:	HPA018142    Human Protein Atlas characterization data

Кат. номер

HPA018142-100UL

HPA018142-25UL

The gene SET domain bifurcated-1 (SETDB1) is located in human chromosome 1 (1q21). The encoded protein contains a DNA methyl binding domain and catalytic SET domain at the N- and C-terminus respectively. In non­-small lung cancer cells SETDB1 is present mainly in the nucleus, with additional cytoplasmic expression. Similarly, mouse embryos showed SETDB1 signal in the nucleus.
Histone-lysine N-methyltransferase SETDB1 recombinant protein epitope signature tag (PrEST)
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper),
Biochem/physiol Actions
SET domain bifurcated-1 (SETDB1) is responsible for methylation of histone 3 lysine-9 in euchromatic region, resulting in a repressed transcription mark. During DNA replication, it is recruited by Methyl-CpG-binding domain protein-1 (MBD1) and forms a replication coupled complex with chromatin assemble factor CAF-1 to methylate lysine-9 at the newly deposited histone 3. The gene is up-regulated in glioma tissues, melanomas, non-small and small lung cancers. SETDB1 undergoes gene amplification in lung tumorigenesis. Higher expression causes stimulation of WNT-β-catenin pathway and down-regulation of P53 expression, resulting in enhanced non-small cell lung cancer growth. Role of SETDB1 in cancer is also suggested by its association with the promyelocytic nuclear leukemia-nuclear bodies and increased expression in broncoepithelial cells. SETDB1 is involved in proviral silencing during embryogenesis when DNA methylation is dynamically reprogrammed.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73723,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	KLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGQLRTRPNMGAVRSKGPVVQYTQD
conjugate	unconjugated
UniProt accession no.	Q15047,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... SETDB1(9869)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable