- Производитель:
- Sigma-Aldrich
| MDL number: | MFCD01868281 |
| Human Protein Atlas Number: | HPA005575 Human Protein Atlas characterization data |
| Кат. номер |
| HPA005575-100UL |
| HPA005575-25UL |
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper),
Biochem/physiol Actions
Tissue factor pathway inhibitor (TFPI), also referred to as EPI, down regulates tissue factor initiated blood coagulation. It has a nonspecific association with cell surface glycosaminoglycans and binding to glycosyl phosphatidylinositol-anchored proteins. It also binds specifically and saturably to thrombospondin-1 (TSP-1). TFPI may be involved in inhibiting factor X and VIIa, which are blood clotting factors, thus possessing an antithrombotic action and also the ability to associate with lipoproteins in plasma.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| packaging | antibody small pack of 25 µL |
| enhanced validation | recombinant expression |
| application(s) | immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 |
| immunogen sequence | QNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRA |
| conjugate | unconjugated |
| UniProt accession no. | P10646, |
| shipped in | wet ice |
| storage temp. | 20°C |
| Gene Information | human ... TFPI(7035) |
| Personal Protective Equipment | Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), |
| RIDADR | NONH for all modes of transport |
| WGK Germany | WGK 1 |
| Flash Point F | Not applicable |
| Flash Point C | Not applicable |
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.

